Aquaporin-12A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-54696-25ul

Product Code. 18621408

Description

Aquaporin-12A Polyclonal specifically detects Aquaporin-12A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Aquaporin-12A
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: AQP-12, AQP12AQPX2aquaporin X2, aquaporin 12, aquaporin 12A, aquaporin-12A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AQP12A
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:FQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE
• Quantity: 25 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 375318
• Target Species: Human
• Isotype: IgG

For Research Use Only