missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALG13 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£177.00
Specifications
| Antigen | ALG13 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18643091
|
Novus Biologicals
NBP2-92394-0.02ml |
0.02 mL |
£177.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18656831
|
Novus Biologicals
NBP2-92394-0.1ml |
0.1 mL |
N/A
|
N/A | |||||
Description
ALG13 Polyclonal antibody specifically detects ALG13 in Human, Mouse samples. It is validated for Western BlotSpecifications
| ALG13 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| Asparagine-linked glycosylation 13 homolog, asparagine-linked glycosylation 13 homolog (S. cerevisiae), chromosome X open reading frame 45, CXorf45, EC 2.4.1.141, FLJ23018, FLJ31785, GLT28D1, glycosyltransferase 28 domain containing 1, Glycosyltransferase 28 domain-containing protein 1, hematopoietic stem/progenitor cells protein MDS031, MDS031, MGC12423, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, YGL047W | |
| A synthetic peptide corresponding to a sequence within amino acids 100-167 of human ALG13 (NP_001311219.1). VVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS with 50% glycerol, pH7.3. | |
| 79868 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title