missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ALG13 Antibody - Azide and BSA Free, Novus Biologicals™

ALG13 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18643091 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18643091 0.02 mL 0.02mL
18656831 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18643091 Supplier Novus Biologicals Supplier No. NBP2923940.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ALG13 Polyclonal antibody specifically detects ALG13 in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ALG13
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias Asparagine-linked glycosylation 13 homolog, asparagine-linked glycosylation 13 homolog (S. cerevisiae), chromosome X open reading frame 45, CXorf45, EC 2.4.1.141, FLJ23018, FLJ31785, GLT28D1, glycosyltransferase 28 domain containing 1, Glycosyltransferase 28 domain-containing protein 1, hematopoietic stem/progenitor cells protein MDS031, MDS031, MGC12423, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, YGL047W
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-167 of human ALG13 (NP_001311219.1). VVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79868
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.