missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Albumin Rabbit anti-Human, Mouse, Rat, Bovine, Clone: 3O4L7, Novus Biologicals™
Rabbit Monoclonal Antibody
£150.00 - £386.00
Specifications
| Antigen | Albumin |
|---|---|
| Clone | 3O4L7 |
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18385214
|
Novus Biologicals
NBP3-15415-20UL |
20 μg |
£150.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18351497
|
Novus Biologicals
NBP3-15415-100UL |
100 μg |
£386.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Albumin Monoclonal antibody specifically detects Albumin in Human, Mouse, Rat, Bovine samples. It is validated for Western BlotSpecifications
| Albumin | |
| Western Blot 1:500 - 1:2000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat, Bovine | |
| albumin, cell growth inhibiting protein 42, DKFZp779N1935, growth-inhibiting protein 20, PRO0883, PRO0903, PRO1341, serum albumin | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of bovine Serum Albumin/ BSA (P02769). KVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 3O4L7 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 213 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title