missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Albumin Rabbit anti-Human, Mouse, Rat, Bovine, Clone: 3O4L7, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-15415-100UL
This item is not returnable.
View return policy
Description
Albumin Monoclonal antibody specifically detects Albumin in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot
Specifications
| Albumin | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat, Bovine | |
| Purified |
| Western Blot | |
| 3O4L7 | |
| Western Blot 1:500 - 1:2000 | |
| albumin, cell growth inhibiting protein 42, DKFZp779N1935, growth-inhibiting protein 20, PRO0883, PRO0903, PRO1341, serum albumin | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of bovine Serum Albumin/ BSA (P02769). KVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC | |
| 100 μg | |
| Apoptosis, Cancer, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers | |
| 213 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction