missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Albumin Rabbit anti-Human, Mouse, Rat, Bovine, Clone: 3O4L7, Novus Biologicals™

Albumin Rabbit anti-Human, Mouse, Rat, Bovine, Clone: 3O4L7, Novus Biologicals™

Product Code. 18385214 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18385214 20 μg 20µL
18351497 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18385214 Supplier Novus Biologicals Supplier No. NBP31541520UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Albumin Monoclonal antibody specifically detects Albumin in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Albumin
Applications Western Blot
Classification Monoclonal
Clone 3O4L7
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias albumin, cell growth inhibiting protein 42, DKFZp779N1935, growth-inhibiting protein 20, PRO0883, PRO0903, PRO1341, serum albumin
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of bovine Serum Albumin/ BSA (P02769). KVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 213
Target Species Human, Mouse, Rat, Bovine
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.