accessibility menu, dialog, popup

UserName

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

brands

  • (163)
  • (54)

special programs

  • (40)

Quantity

  • (3)
  • (103)
  • (37)
  • (1)
  • (1)
  • (5)
  • (15)
  • (1)
  • (1)
  • (1)
  • (1)

Applications

  • (3)
  • (10)
  • (18)
  • (42)
  • (3)
  • (1)
  • (12)
  • (1)
  • (10)
  • (28)
  • (84)
  • (1)
  • (4)
  • (2)
  • (45)

Conjugate

  • (2)
  • (9)
  • (11)
  • (5)
  • (10)
  • (3)
  • (10)
  • (6)
  • (11)
  • (3)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (4)
  • (1)
  • (5)
  • (4)
  • (4)
  • (1)
  • (4)
  • (49)
  • (4)
  • (3)
  • (4)

Regulatory Status

  • (164)

Target Species

  • (1)
  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (146)
  • (1)
  • (19)
  • (3)
  • (1)
  • (1)
  • (13)
  • (4)
  • (1)
  • (10)

Classification

  • (138)
  • (25)

Form

  • (163)

Host Species

  • (1)
  • (77)
  • (79)
  • (6)

Isotype

  • (55)
  • (41)
  • (14)
  • (17)
  • (12)
  • (15)
  • (9)

For Use With (Application)

  • (5)
  • (5)
  • (5)
  • (1)
  • (5)
1 – 15 of 208 results
3

CYTB Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Antigen CYTB
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunohistochemistry-Paraffin
Gene Alias cytochrome b, MTCYB, MT-CYB mitochondrially encoded cytochrome b
Gene ID (Entrez) 4519
Formulation PBS with 50% glycerol, pH7.3.
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CYTB (YP_003024038.1). RGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFL
Classification Polyclonal
Primary or Secondary Primary
5

NCKAP1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Research Discipline Apoptosis
Antigen NCKAP1
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:2000
Gene Alias FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1
Gene ID (Entrez) 10787
Formulation PBS (pH 7.3), 50% glycerol
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1). MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC
Classification Polyclonal
Primary or Secondary Primary
6

STING/TMEM173 Antibody (STING1/8187R), Novus Biologicals™

Rabbit Monoclonal Antibody

Content And Storage Store at 4&drg;C. Do not freeze.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG κ
Research Discipline Cancer, Immunology, Innate Immunity
Concentration 0.2 mg/ml
Antigen STING/TMEM173
Regulatory Status RUO
Purification Method Protein A or G purified
Dilution Immunohistochemistry-Paraffin 1-2 μg/mL
Gene Alias endoplasmic reticulum IFN stimulator, Endoplasmic reticulum interferon stimulator, ERIS, FLJ38577, hMITA, hSTING, Mediator of IRF3 activation, MITA, mitochondrial mediator of IRF3 activation, MPYS, NET23, N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner, SAVI, Stimulator of interferon genes protein, stimulator of interferon protein, sting, STING-beta, TMEM173, transmembrane protein 173
Gene ID (Entrez) 340061
Formulation 10mM PBS with 0.05% BSA
Immunogen Recombinant fragment (around aa190-290) of human STING/TMEM173 protein (exact sequence is proprietary)
Classification Monoclonal
Primary or Secondary Primary
Clone STING1/8187R
10

Human Perforin Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Purified
Isotype IgG
Gene Accession No. P14222
Antigen Perforin
Regulatory Status RUO
Purification Method Protein A or G purified from cell culture supernatant
Dilution Immunohistochemistry 5-25 ug/mL
Gene Alias Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFP, PFPcytolysin, PRF1
Gene ID (Entrez) 5551
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Chinese Hamster Ovary cell line CHO-derived human Perforin, Pro22-Trp555, Accession # P14222
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2771C
11

Human Desmocollin-1 Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Purified
Isotype IgG
Gene Accession No. Q08554
Antigen Desmocollin-1
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Immunohistochemistry 3-25 ug/mL
Gene Alias cadherin family member 1, CDHF1, desmocollin 1, desmocollin-1, Desmocollin1, desmosomal glycoprotein 2/3, DG2/DG3, DSC1
Gene ID (Entrez) 1823
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Mouse myeloma cell line, NS0-derived human Desmocollin-1, Arg135-Asn686, Accession # Q08554
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2906A
13

Human alpha 2-Macroglobulin Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG1
Antigen alpha 2-Macroglobulin
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution ELISA
Gene Alias A2M, alpha 2Macroglobulin, Alpha-2-M, alpha-2-macroglobulin, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5, CPAMD5, CPAMD5DKFZp779B086, FWP007, S863-7
Gene ID (Entrez) 2
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Human plasma-derived alpha 2-Macroglobulin
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 257303
14

Novus Biologicals™ FoxP3

Foxp3, human (full length cDNA) in PCLXSN Retroviral expression vector

15

Novus Biologicals™ ROR alpha Plasmid

For expression of hROR alpha protein in mammalian cells, induction of G6Pase promoter activity