Search Results Page | Fisher Scientific

1 – 15 of 208 results

Rabbit Polyclonal Antibody

All Primary Antibodies

Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Purified
Isotype	IgG
Research Discipline	Apoptosis
Antigen	NCKAP1
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 1:500-1:2000
Gene Alias	FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1
Gene ID (Entrez)	10787
Formulation	PBS (pH 7.3), 50% glycerol
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1). MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC
Classification	Polyclonal
Primary or Secondary	Primary

Rabbit Monoclonal Antibody

All Primary Antibodies

Content And Storage	Store at 4&drg;C. Do not freeze.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG κ
Research Discipline	Cancer, Immunology, Innate Immunity
Concentration	0.2 mg/ml
Antigen	STING/TMEM173
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Immunohistochemistry-Paraffin 1-2 μg/mL
Gene Alias	endoplasmic reticulum IFN stimulator, Endoplasmic reticulum interferon stimulator, ERIS, FLJ38577, hMITA, hSTING, Mediator of IRF3 activation, MITA, mitochondrial mediator of IRF3 activation, MPYS, NET23, N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner, SAVI, Stimulator of interferon genes protein, stimulator of interferon protein, sting, STING-beta, TMEM173, transmembrane protein 173
Gene ID (Entrez)	340061
Formulation	10mM PBS with 0.05% BSA
Immunogen	Recombinant fragment (around aa190-290) of human STING/TMEM173 protein (exact sequence is proprietary)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	STING1/8187R

Mammalian expression vector construct, pCMV/hRUNX1, containing coding sequence of human Runt-related transcription factor 1

Plasmid DNA

Rabbit Monoclonal Antibody

All Primary Antibodies

Rabbit Monoclonal Antibody

All Primary Antibodies

Applications: Retroviral Production

DNA Vectors

Mouse Monoclonal Antibody

All Primary Antibodies

Rabbit Monoclonal Antibody

All Primary Antibodies

Mouse Monoclonal Antibody

All Primary Antibodies

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA
Form	Purified
Isotype	IgG1
Gene Accession No.	NP_037359
Antigen	Aggrecan
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	ELISA
Gene Alias	ACAN, AGC1, AGC1SEDK, aggrecan, aggrecan core protein, Cartilage-specific proteoglycan core protein, Chondroitin sulfate proteoglycan 1, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1, CSPG1aggrecan 1, CSPGCP, large aggregating proteoglycan, MSK16, MSK16AGCAN, SEDK
Gene ID (Entrez)	176
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen	Mouse myeloma cell line NS0-derived recombinant human Aggrecan, Val20-Gly675, Accession # NP_037359
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Clone	179503