All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (983)
- (16)
- (141)
- (483)
- (3)
- (4)
- (328)
- (74)
- (1)
- (788)
- (3)
- (2)
- (7)
- (2)
- (124)
- (2)
- (5)
- (93)
- (135)
- (53)
- (744)
- (2)
- (5)
- (4,552)
- (5,868)
- (2)
- (2)
- (28)
- (27)
- (7)
- (6)
- (1)
- (137)
- (233)
- (1)
- (74)
- (2)
- (1)
- (8,717)
- (43)
- (419)
- (745)
- (6)
- (348)
- (2)
- (1)
- (149)
- (1)
- (9)
- (10)
- (62)
- (2)
- (23)
- (622)
- (30)
- (8)
- (82,378)
- (2)
- (57)
- (46)
- (184)
- (18)
- (383)
- (3,152)
- (3)
- (4)
- (1,329)
- (6)
- (3)
- (395,040)
- (24)
- (11,999)
- (10,790)
- (1,525)
- (374)
- (215)
- (77)
- (5,822)
- (4)
- (168)
- (17)
- (2)
- (28)
- (914)
- (7)
- (2)
- (15)
- (18)
- (1)
- (182)
- (10)
- (284,429)
- (2,540)
- (22,171)
- (83)
- (2)
- (50)
- (39)
- (4)
- (139)
- (2)
- (23,533)
- (96)
- (1)
- (137)
- (825)
- (11,503)
- (3)
- (2)
- (163)
- (25)
- (2)
- (9)
- (761)
- (2)
- (2)
- (72)
- (29)
- (3)
- (309)
- (1,229)
- (2,374)
- (4)
- (219,162)
- (145,003)
- (155)
- (25)
- (162,944)
- (469,066)
- (2)
- (2)
- (3)
- (75)
- (1,277)
- (35,493)
- (14)
- (244)
- (12,287)
- (477,919)
- (203)
- (3)
- (480)
- (2)
- (3)
- (385)
- (6)
- (4)
- (156,337)
- (2,178)
- (3)
- (49)
- (512)
- (3)
- (657)
- (1,079)
- (1,275)
- (6)
- (8)
- (985)
- (4)
- (3)
- (51)
- (11,137)
- (6)
- (721)
- (34)
- (9)
- (2)
- (381)
- (4)
- (3)
- (2)
- (22)
- (42)
- (1,254)
- (2)
- (19)
- (1,804)
- (1)
- (4)
- (216)
- (451)
- (261)
- (34)
- (24,826)
- (22)
- (11)
- (1)
- (160)
- (78)
- (411)
- (1,985)
- (5)
- (2)
- (3)
- (2)
- (21,418)
- (14)
- (2)
- (4)
- (1,420)
- (3)
- (2)
- (2)
- (1)
- (135)
- (2)
- (2,344)
- (93)
- (3)
- (12)
- (23)
- (1,100)
- (1)
- (4)
- (2)
- (6,278)
- (4,049)
- (3,224)
- (1)
- (11)
- (5,209)
- (2)
- (450)
- (430)
- (3)
- (22)
- (32)
- (9)
- (2,560)
- (167)
- (4)
- (13)
- (44)
- (1)
- (2)
- (3)
- (1)
- (2)
- (876,394)
- (3)
- (8,254)
- (46)
- (10)
- (1)
- (2)
- (1)
- (3,052)
- (910)
- (2,431)
- (4,284)
- (1)
- (1)
- (1)
- (1)
- (1,319)
- (3,299)
- (811,194)
- (17,473)
- (9)
- (835)
- (54)
- (1)
- (5)
- (1)
- (4,918)
- (880)
- (1,519)
- (197)
- (1)
- (4)
- (4,095)
- (890)
- (1)
- (3)
- (408)
- (4)
- (1)
- (3,319)
- (3,719)
- (2)
- (1)
- (1)
- (5)
- (1)
- (256)
- (134)
- (44)
- (1)
- (1)
- (1)
- (117)
- (230)
- (3)
- (1)
- (12)
- (265)
- (2)
- (140,537)
- (199,452)
- (1)
- (805)
- (10,886)
- (2)
- (10)
- (10)
- (6)
- (20)
- (1)
- (7)
- (34)
- (15)
- (4)
- (1)
- (105)
- (1)
- (1)
- (20)
- (9)
- (20)
- (3)
- (14,207)
- (655)
- (1)
- (1)
- (3)
- (2)
- (148)
- (332)
- (219)
- (81)
- (1)
- (1)
- (6)
- (26,243)
- (2)
- (5,278)
- (1)
- (64)
- (10)
- (1)
- (4,389)
- (3,084)
- (1)
- (75)
- (1)
- (1)
- (2)
- (16,903)
- (17,156)
- (5,782)
- (284)
- (16)
- (15)
- (1)
- (102)
- (567)
- (19)
- (1)
- (1)
- (1)
- (2)
- (2,135)
- (1)
- (3)
- (1)
- (6)
- (2)
- (1)
- (201)
- (2)
- (20)
- (1)
- (108)
- (1)
- (1)
- (5)
- (1)
- (1)
- (12)
- (1)
- (4)
- (40)
- (4,902)
- (6)
- (2)
- (2)
- (5)
- (4)
- (12)
- (249)
- (2)
- (12,027)
- (32,573)
- (1)
- (52)
- (1,525)
- (282)
- (7)
- (1)
- (2,402)
- (1)
- (4,430)
- (83)
- (38)
- (1)
- (10)
- (1)
- (4)
- (30)
- (1)
- (993)
- (1)
- (1)
- (13)
- (4)
- (7)
- (2)
- (6)
- (1)
- (96)
- (8)
- (715,405)
- (6)
- (3)
- (629,099)
- (30,377)
- (62)
- (546)
- (565)
- (2,741)
- (1)
- (14)
- (1,668)
- (2)
- (2)
- (2)
- (5)
- (5)
- (56,701)
- (73)
- (119)
- (6)
- (1,417)
- (21,220)
- (35)
- (51)
- (112)
- (8)
- (22)
- (538,476)
- (1)
- (8)
- (660,773)
- (61,721)
- (29,172)
- (186)
- (1)
- (1)
- (25,540)
- (9)
- (4)
- (1)
- (10)
- (2,869)
- (66)
- (105)
- (301)
- (1)
- (4)
- (2)
- (1)
- (18)
- (31,275)
- (31,340)
- (6)
- (32,215)
- (16)
- (31,004)
- (72)
- (48)
- (31,309)
- (2)
- (32,085)
- (1)
- (3)
- (1)
- (74)
- (31,753)
- (31,256)
- (17,368)
- (17,335)
- (17,225)
- (17,387)
- (17,191)
- (23)
- (106)
- (5)
- (79)
- (97)
- (97)
- (62)
- (16)
- (32,988)
- (11)
- (222)
- (713)
- (931)
- (625)
- (701)
- (819)
- (776)
- (954)
- (729)
- (1,294)
- (798)
- (738)
- (908)
- (939)
- (929)
- (1)
- (606)
- (940)
- (31)
- (8)
- (27,423)
- (854)
- (5)
- (129)
- (4)
- (680)
- (6)
- (151)
- (81)
- (84)
- (1,919)
- (17)
- (13)
- (11)
- (31)
- (5)
- (18)
- (1)
- (26,950)
- (26,945)
- (27,066)
- (43)
- (27,001)
- (26,907)
- (40)
- (26,967)
- (26,938)
- (26,951)
- (8)
- (10)
- (17)
- (18)
- (30,190)
- (3)
- (5)
- (42)
- (1)
- (4)
- (3)
- (1)
- (4)
- (241)
- (1,273)
- (27,297)
- (14,111)
- (26,007)
- (4,866)
- (4,867)
- (25,995)
- (14,068)
- (7)
- (7)
- (13)
- (1)
- (190)
- (32)
- (55)
- (109)
- (56)
- (235)
- (302)
- (53)
- (166)
- (62)
- (24)
- (54)
- (80)
- (30)
- (137)
- (138)
- (175)
- (162)
- (162)
- (26)
- (68)
- (68)
- (42)
- (58)
- (107)
- (101)
- (189)
- (236)
- (77)
- (114)
- (126)
- (154)
- (78)
- (449)
- (26,690)
- (7)
- (5)
- (258)
- (379)
- (2,763)
- (3,756)
- (24)
- (30)
- (265)
- (2,697)
- (2)
- (1)
- (128)
- (43)
- (22,748)
- (587)
- (612)
- (4)
- (14)
- (13)
- (5)
- (7)
- (62)
- (59)
- (886)
- (64)
- (1)
- (3)
- (1)
- (13)
- (5)
- (5)
- (39)
- (1)
- (370)
- (327)
- (169)
- (176)
- (115)
- (38)
- (16)
- (5)
- (5)
- (9)
- (3)
- (10)
- (2)
- (67)
- (5)
- (420,123)
- (280)
- (49)
- (441)
- (83)
- (56)
- (28)
- (318)
- (1)
- (23,827)
- (23,812)
- (23,797)
Filtered Search Results
Invitrogen™ CD86 Monoclonal Antibody (GL-1)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rat Monoclonal Antibody
Invitrogen™ GATA3 Monoclonal Antibody (A3G6)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
B7-2/CD86 Antibody (AP-MAB0803) - Azide and BSA Free, Novus Biologicals™
Rat Monoclonal Antibody has been used in 2 publications
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | CyTOF,Flow Cytometry,Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG2 |
| Research Discipline | Adaptive Immunity, Cell Cycle and Replication, Dendritic Cell Markers, Diabetes Research, Immunology |
| Concentration | 0.5 mg/mL |
| Antigen | B7-2/CD86 |
| Gene Symbols | CD86 |
| Purification Method | Protein G purified |
| Dilution | Flow Cytometry 1:100-1000, Immunohistochemistry 1:-300-2000, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:-300-2000, CyTOF-ready |
| Gene Alias | Activation B7-2 antigen, B70, B7-2, B7-2 antigen, B-lymphocyte activation antigen B7-2, BU63, CD28 antigen ligand 2, CD28LG2B7-2 antigen), CD86 antigen, CD86 molecule, CTLA-4 counter-receptor B7.2, FUN-1, LAB72, MGC34413, T-lymphocyte activation antigen CD86 |
| Gene ID (Entrez) | 942 |
| Formulation | A 0.2 um filtered solution in PBS with No Preservative |
| Classification | Monoclonal |
| Immunogen | Mouse CD86 |
| Primary or Secondary | Primary |
| Clone | AP-MAB0803 |
Invitrogen™ beta Actin Loading Control Monoclonal Antibody (BA3R), DyLight™ 680
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R), DyLight™ 680
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Western Blot |
| Form | Purified |
| Isotype | IgG |
| Antigen | NXF1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500 - 1:1000, ELISA |
| Gene Alias | DKFZp667O0311, Mex67, mRNA export factor TAP, nuclear RNA export factor 1, TAPMEX67, tip associating protein, Tip-associated protein, Tip-associating protein |
| Gene ID (Entrez) | 10482 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NXF1 (NP_006353.2).,, Sequence:, ILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunocytochemistry/Immunofluorescence,Immunoprecipitation,Western Blot |
| Form | Purified |
| Isotype | IgG |
| Antigen | NXF1 |
| Regulatory Status | RUO |
| Purification Method | Antigen and protein A Affinity-purified |
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:100-1:500, Immunoprecipitation 1-5ul/mg of lysate |
| Gene Alias | DKFZp667O0311, Mex67, mRNA export factor TAP, nuclear RNA export factor 1, TAPMEX67, tip associating protein, Tip-associated protein, Tip-associating protein |
| Gene ID (Entrez) | 10482 |
| Formulation | PBS, pH7.0 |
| Classification | Polyclonal |
| Immunogen | Produced in rabbits immunized with E. coli-derived Human NXF1 fragment. |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4C. |
|---|---|
| Conjugate | Unconjugated |
| Target Species | Human |
| Host Species | Mouse |
| Applications | ELISA,Flow Cytometry,Immunocytochemistry,Immunofluorescence |
| Form | Purified |
| Isotype | IgG1 κ |
| Antigen | IgG |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Gene Alias | immunoglobulin heavy constant gamma 1 (G1m marker) |
| Formulation | PBS with 0.05% BSA. with 0.05% Sodium Azide |
| Gene ID (Entrez) | 3500 |
| Classification | Monoclonal |
| Immunogen | Purified human Ig Gamma Chain |
| Primary or Secondary | Primary |
| Clone | ICO-97 |
| Content And Storage | Store at 4°C. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Adaptive Immunity, Epitope Tags, Immunology |
| Antigen | IgG |
| Regulatory Status | RUO |
| Purification Method | Immunogen affinity purified |
| Dilution | Immunohistochemistry 1:100-1:300, Immunohistochemistry-Paraffin 1:100-1:300 |
| Gene Alias | Immunoglobulin G, ImmunoglobulinG |
| Gene ID (Entrez) | 3500 |
| Formulation | 20 mM Tris-HCl, pH 8.0, 20 mg/ml BSA |
| Classification | Monoclonal |
| Immunogen | Peptide derived from internal domain of human IgG-1 chain C region. Antibody recognizes the epitope betweenVal167 - Val185. |
| Primary or Secondary | Primary |
| Clone | E20-V |
Human IgG Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Monoclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Supernatant |
| Isotype | IgG |
| Antigen | IgG |
| Purification Method | Protein A or G purified from cell culture supernatant |
| Dilution | ELISA |
| Gene Alias | Immunoglobulin G, ImmunoglobulinG |
| Gene ID (Entrez) | 3500 |
| Formulation | Lyophilized from a 0.2μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2μm filtered solution in PBS. |
| Immunogen | Purified IgG from human serum |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human IgG in direct ELISAs. As a pan-Human IgG-specific antibody, sandwich immunoassay specificity is determined by the capture antibody. |
| Clone | 1268C |
| Content And Storage | Store at 4C. |
|---|---|
| Conjugate | Unconjugated |
| Target Species | Human |
| Host Species | Mouse |
| Applications | ELISA,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Protein Array,RNA Immunoprecipitation,Western Blot |
| Form | Purified |
| Isotype | IgG2a κ |
| Antigen | IgG |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Gene Alias | immunoglobulin heavy constant gamma 1 (G1m marker) |
| Formulation | PBS with 0.05% BSA. with 0.05% Sodium Azide |
| Gene ID (Entrez) | 3500 |
| Classification | Monoclonal |
| Immunogen | Purified human Ig Gamma Chain |
| Primary or Secondary | Primary |
| Clone | IG266 |
| Content And Storage | Store at -20° C. Avoid freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Adaptive Immunity, Epitope Tags, Immunology |
| Antigen | IgG |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200 |
| Gene Alias | Immunoglobulin G, ImmunoglobulinG |
| Gene ID (Entrez) | 3500 |
| Formulation | PBS, pH 7.4, 150mM NaCl, 50% glycerol. |
| Immunogen | A synthesized peptide derived from human IgG (Uniprot #: P01857, P01859, P01860, P01861) |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | SR1919 |