accessibility menu, dialog, popup

UserName

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application) 
  • (2)
  • (2)
  • (2)
  • (3)
  • (2)
  • (2)
Recombinant 
  • (6)
Species 
  • (4)
  • (2)
Conjugate 
  • (5)
Form 
  • (5)
Keyword Search: C/4920 Clear all selections

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

C/4920

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (2)
  • (3)
  • (2)

For Use With (Application)

  • (2)
  • (2)
  • (2)
  • (3)
  • (2)
  • (2)

Recombinant

  • (6)

Species

  • (4)
  • (2)

Conjugate

  • (5)

Form

  • (5)
1 – 5 of 5 results
1

Invitrogen™ Human ROR2, GST Tag Recombinant Protein

Recombinant Protein

Content And Storage -80°C, Avoid Freeze/Thaw Cycles
Conjugate Unconjugated
Form Liquid
Common Name ROR2
Molecular Weight (g/mol) 85.2 kDa
KinaseFamily ROR Kinase Family
Concentration See Label
Expression System Baculovirus
For Use With (Application) Kinase Assay
Name Human ROR2, GST Tag
Accession Number Q01974
Regulatory Status RUO - research use only
Gene Alias BDB; BDB1; mRor2; neurotrophic tyrosine kinase receptor-related 2; neurotrophic tyrosine kinase, receptor related 2; neurotrophic tyrosine kinase, receptor-related 2; NTRKR2; receptor tyrosine kinase like orphan receptor 2; receptor tyrosine kinase-like orphan receptor 2; ROR2; Tyrosine-protein kinase transmembrane receptor ROR2
Protein Length 425-923
Gene ID (Entrez) 4920
Formulation 50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag GST-tag
Species Human
Recombinant Recombinant
4

R&D Systems™ Recombinant Human ROR2 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

5

Abnova™ Human ROR2 Partial ORF (NP_004551, 34 a.a. - 143 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name ROR2
Molecular Weight (g/mol) 37.84kDa
Gene Symbol ROR2
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,ELISA,Protein Array,Western Blot
Name ROR2 (Human) Recombinant Protein (Q01)
Accession Number NP_004551
Regulatory Status RUO
Gene Alias BDB/BDB1/MGC163394/NTRKR2
Gene ID (Entrez) 4920
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant