Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
951,843
résultats
| Symboles de gène(s) | TP53BP1 |
|---|---|
| Alias de gène | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Applications | Western Blot,ELISA |
|---|---|
| Spécificité du test | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
| Isotype | IgG1 κ |
| Conjugué | Unconjugated |
| Espèces cibles | Bacteria |
| Concentration | 1 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Dilution | Western Blot, ELISA |
| Immunogène | Recombinant Listeria monocytogenes p60. |
| Classification | Monoclonal |
| Méthode de purification | Protein G purified |
| Espèces hôtes | Mouse |
| Formule | 0.2um-filtered solution in PBS, pH 7.4. |
| Alias de gène | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Clone | p6007 |
| Antigène | Listeria monocytogenes p60 |
Rabbit IgG Isotype Control, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 36 publications
Histone H2AX, p Ser139 Antibody (3F2), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 6 publications
| Applications | Western Blot |
|---|---|
| Spécificité du test | In Western blot this antibody detects ∼17 kDa protein representing phosphorylated H2AX in gamma irradiated HeLa cell lysate. In immunofluorescence procedures, recognizes phosphorylated H2AX in gamma irradiated HeLa cells. ELISA of phosphorylated H2AX can also be performed. Used in IHC to successfully detect H2A.X pSer140 in postnatal mouse lung section. |
| Isotype | IgG1 κ |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Concentration | 1 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at -20°C. Avoid freeze/thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Numéro d’ordre du gène | P16104 |
| Dilution | Western Blot 1 μg/mL, Simple Western 10 μg/mL, Flow Cytometry 1 μg 106 cells, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 2 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10 - 1:500 |
| Immunogène | This Histone H2AX [p Ser139] Antibody (3F2) was developed against a synthetic peptide sequence surrounding phosphorylated Ser139. |
| Poids moléculaire de l’antigène | 15 kDa |
| Classification | Monoclonal |
| Identification génétique (Entrez) | 3014 |
| Méthode de purification | Protein G purified |
| Disciplines de recherche | Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Mitotic Regulators, Phospho Specific |
| Espèces hôtes | Mouse |
| Symboles de gène(s) | H2AFX |
| Alias de gène | H2A.X, H2A/X, H2AFX |
| Clone | 3F2 |
| Antigène | Histone H2AX (p Ser139) |
| Poids moléculaire | 33.4 kDa |
|---|---|
| Protéine | Protein A |
| Conditions de stockage | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Catégorie de recherche | Epitope Tags |
| Concentration en endotoxines | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Pureté ou qualité | >97% pure by SDS-PAGE and HPLC |
| Reconstitution | Dissolve in distilled water or saline. |
| Identification génétique (Entrez) | 3919448 |
| Concentration | LYOPH |
| Formule | Lyophilized from additive free solution. |
| Alias de gène | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| À utiliser avec (application) | PAGE,Bioactivity,HPLC |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
|---|---|
| Spécificité du test | Specificity of human KERA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human,Mouse |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 11081 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | KERA |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | CNA2, keratocan, KTN, SLRR2BKeratan sulfate proteoglycan keratocan |
| Antigène | KERA |
| Applications | Western Blot,ELISA |
|---|---|
| Isotype | IgG1 |
| Conjugué | Unconjugated |
| Concentration | 1 mg/mL |
| Primaire ou secondaire | Primary |
| Forme | Purified |
| Dilution | Western Blot 1:100-1:2000, ELISA 1:100-1:2000 |
| Immunogène | Purified recombinant fragment of human ARHGAP42 (AA: 577-719) expressed in E. Coli. |
| Poids moléculaire de l’antigène | 98.6 kDa |
| Classification | Monoclonal |
| Identification génétique (Entrez) | 143872 |
| Méthode de purification | Protein G purified |
| Espèces hôtes | Mouse |
| Symboles de gène(s) | ARHGAP42 |
| Alias de gène | FLJ32810, Rho GTPase activating protein 42 |
| Clone | 2F1A7 |
| Antigène | ARHGAP42 |