missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZSWIM3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ZSWIM3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZSWIM3 Polyclonal specifically detects ZSWIM3 in Human samples. It is validated for Western Blot.Specifications
| ZSWIM3 | |
| Polyclonal | |
| Rabbit | |
| Q96MP5 | |
| 140831 | |
| Synthetic peptides corresponding to ZSWIM3(zinc finger, SWIM-type containing 3) The peptide sequence was selected from the N terminal of ZSWIM3. Peptide sequence SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| human ZW10 interacting protein-1, HZwint-1, KNTC2AP, MGC117174, ZW10 interactor, ZW10-interacting protein 1, zwint-1, ZWINT1 | |
| ZSWIM3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title