ZSWIM3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56683

Product Code. 18272315

Description

ZSWIM3 Polyclonal specifically detects ZSWIM3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZSWIM3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: human ZW10 interacting protein-1, HZwint-1, KNTC2AP, MGC117174, ZW10 interactor, ZW10-interacting protein 1, zwint-1, ZWINT1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 140831
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96MP5
• Gene Symbols: ZSWIM3
• Immunogen: Synthetic peptides corresponding to ZSWIM3(zinc finger, SWIM-type containing 3) The peptide sequence was selected from the N terminal of ZSWIM3. Peptide sequence SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Pig: 100%; Canine: 92%; Rabbit: 92%; Mouse: 85%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG