missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZSCAN5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | ZSCAN5 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ZSCAN5 Polyclonal specifically detects ZSCAN5 in Human samples. It is validated for Western Blot.Specifications
| ZSCAN5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| MGC4161, zinc finger and SCAN domain containing 5, zinc finger and SCAN domain containing 5A, zinc finger and SCAN domain-containing protein 5A, Zinc finger protein 495ZSCAN5, ZNF495 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of human ZSCAN5 (NP_077279.1). Peptide sequence KVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLKLLRRHQKTHPEATSQ | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 79149 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title