ZSCAN5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10515-100UL

Product Code. 18333857

Description

ZSCAN5 Polyclonal specifically detects ZSCAN5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZSCAN5
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: MGC4161, zinc finger and SCAN domain containing 5, zinc finger and SCAN domain containing 5A, zinc finger and SCAN domain-containing protein 5A, Zinc finger protein 495ZSCAN5, ZNF495
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ZSCAN5 (NP_077279.1). Peptide sequence KVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLKLLRRHQKTHPEATSQ
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79149
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.