missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£361.00
Specifications
| Antigen | ZP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
ZP2 Polyclonal specifically detects ZP2 in Human samples. It is validated for Western Blot.Specifications
| ZP2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Zona pellucida glycoprotein 2, zona pellucida glycoprotein 2 (sperm receptor), zona pellucida glycoprotein ZP2, Zona pellucida protein A, zona pellucida sperm-binding protein 2, Zp-2 | |
| ZP2 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q05996 | |
| 7783 | |
| Synthetic peptides corresponding to ZP2(zona pellucida glycoprotein 2 (sperm receptor)) The peptide sequence was selected from the C terminal of ZP2. Peptide sequence PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title