missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF703 Antibody (CL0654), Novus Biologicals™
Mouse Monoclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | ZNF703 |
|---|---|
| Clone | CL0654 |
| Dilution | Western Blot 1 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18605788
|
Novus Biologicals
NBP2-52940 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18610548
|
Novus Biologicals
NBP2-52940-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
ZNF703 Monoclonal antibody specifically detects ZNF703 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDownSpezifikation
| ZNF703 | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated | |
| Monoclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 80139 | |
| IgG1 | |
| Protein A purified |
| CL0654 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| Mouse | |
| Human | |
| FLJ14299, ZEPPO1, Zinc finger elbow-related proline domain protein 1, zinc finger protein 703, ZNF503L, ZPO1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts