missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF703 Antibody (CL0654), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-52940-25ul
This item is not returnable.
View return policy
Description
ZNF703 Monoclonal antibody specifically detects ZNF703 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Specifications
| ZNF703 | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Mouse | |
| Protein A purified | |
| RUO | |
| 80139 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| CL0654 | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated | |
| FLJ14299, ZEPPO1, Zinc finger elbow-related proline domain protein 1, zinc finger protein 703, ZNF503L, ZPO1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSS | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction