missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF667 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ZNF667 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF667 Polyclonal specifically detects ZNF667 in Rat samples. It is validated for Western Blot.Specifications
| ZNF667 | |
| Polyclonal | |
| Rabbit | |
| NP_001008557 | |
| 63934 | |
| The immunogen for this antibody is Znf667 - N-terminal region. Peptide sequence MPAARGKSKSKAPVTFGDLAIYFSQEEWEWLSPNQKDLYEDVMLENYHNL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp686O111, FLJ14011, FLJ45518, MIPU1, myocardial ischemic preconditioning upregulated 1 ortholog, zinc finger protein 667 | |
| ZNF667 | |
| IgG | |
| 66 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title