missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF667 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-98333
This item is not returnable.
View return policy
Description
ZNF667 Polyclonal specifically detects ZNF667 in Rat samples. It is validated for Western Blot.
Specifications
| ZNF667 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp686O111, FLJ14011, FLJ45518, MIPU1, myocardial ischemic preconditioning upregulated 1 ortholog, zinc finger protein 667 | |
| Rabbit | |
| 66 kDa | |
| 100 μL | |
| Primary | |
| Porcine: 86%; Mouse: 86%; Equine: 85%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_001008557 | |
| ZNF667 | |
| The immunogen for this antibody is Znf667 - N-terminal region. Peptide sequence MPAARGKSKSKAPVTFGDLAIYFSQEEWEWLSPNQKDLYEDVMLENYHNL. | |
| Affinity purified | |
| RUO | |
| 63934 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction