ZNF579 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-68922

Product Code. 18241914

Description

ZNF579 Polyclonal specifically detects ZNF579 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF579
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ35453, zinc finger protein 579
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Rat: 86%; Mouse: 86%; .
• Target Species: Human, Mouse, Rat, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NAF0
• Gene Symbols: ZNF579
• Immunogen: Synthetic peptides corresponding to ZNF579 (zinc finger protein 579) The peptide sequence was selected from the C terminal of ZNF579. Peptide sequence LASYLRQHRRVHGPLSLLAPLPAAGKKDDKASGARNSAKGPEGGEGAECG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 163033
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.