missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF502 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF502 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF502 Polyclonal specifically detects ZNF502 in Human samples. It is validated for Western Blot.Specifications
| ZNF502 | |
| Polyclonal | |
| Rabbit | |
| NP_149987 | |
| 91392 | |
| Synthetic peptide directed towards the N terminal of human ZNF502. Peptide sequence IDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KOX17Zinc finger protein 191, lacks zinc finger domain, Retinoic acid suppression protein A, RSG-A, Zfp191, Zinc finger and SCAN domain-containing protein 3, zinc finger protein 24, zinc finger protein 24 (KOX 17), ZNF191, ZSCAN3Zinc finger protein KOX17 | |
| ZNF502 | |
| IgG | |
| 63 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title