missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF274 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | ZNF274 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ZNF274 Polyclonal specifically detects ZNF274 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ZNF274 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| GIOT2, GIOT-2, gonadotropin inducible transcription repressor-2, Gonadotropin-inducible ovary transcription repressor 2, gonadotropin-inducible transcription repressor 2, KOX7DKFZp434F1811, zinc finger protein 44, zinc finger protein 44 (KOX 7), Zinc finger protein 55DKFZp686L21136, Zinc finger protein 58ZNF504, Zinc finger protein KOX7, zinc finger protein ZnFP12, ZNF, ZNF55, ZNF58 | |
| The immunogen is a synthetic peptide directed towards the middle region of human ZNF274 (NP_057408). Peptide sequence SHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 10782 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title