ZNF274 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10523-100UL

Product Code. 18345565

Description

ZNF274 Polyclonal specifically detects ZNF274 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZNF274
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: GIOT2, GIOT-2, gonadotropin inducible transcription repressor-2, Gonadotropin-inducible ovary transcription repressor 2, gonadotropin-inducible transcription repressor 2, KOX7DKFZp434F1811, zinc finger protein 44, zinc finger protein 44 (KOX 7), Zinc finger protein 55DKFZp686L21136, Zinc finger protein 58ZNF504, Zinc finger protein KOX7, zinc finger protein ZnFP12, ZNF, ZNF55, ZNF58
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF274 (NP_057408). Peptide sequence SHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10782
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.