missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF273 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93912-0.1ml
This item is not returnable.
View return policy
Description
ZNF273 Polyclonal antibody specifically detects ZNF273 in Human samples. It is validated for Western Blot
Specifications
| ZNF273 | |
| Polyclonal | |
| Western Blot 1:100 - 1:500 | |
| HZF9, ZNF273 zinc finger protein 273 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 210-260 of human ZNF273 (NP_066971.2). ECGKSCCILSQLTQHKKTATRVNFYKCKTCGKAFNQFSNLTKHKIIHPEVN | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10793 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction