missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF141 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05597-100ul
This item is not returnable.
View return policy
Description
ZNF141 Polyclonal antibody specifically detects ZNF141 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ZNF141 | |
| Polyclonal | |
| Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| D4S90, pHZ-44, zinc finger protein 141 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 405-474 of human ZNF141 (NP_003432.1). RRSTDRSQHKKIHSADKPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIHT | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 7700 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction