missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZDHHC11/ZDHHC11B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Applications | Western Blot |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
ZDHHC11 Polyclonal specifically detects ZDHHC11 in Rat samples. It is validated for Western Blot.Specifications
| Western Blot | |
| Unconjugated | |
| RUO | |
| The immunogen for this antibody is Zdhhc11 (NP_001034431). Peptide sequence TIDPADTNVRLKKDYLEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHC. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| P0C7U3 | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title