ZDHHC11/ZDHHC11B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79327

Product Code. 18250806

Description

ZDHHC11 Polyclonal specifically detects ZDHHC11 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: ZDHHC11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DHHC-11, EC 2.3.1.-, FLJ13153, Zinc finger DHHC domain-containing protein 11, Zinc finger protein 399, zinc finger, DHHC domain containing 11, zinc finger, DHHC-type containing 11, ZNF399probable palmitoyltransferase ZDHHC11
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P0C7U3
• Gene Symbols: ZDHHC11
• Immunogen: The immunogen for this antibody is Zdhhc11 (NP_001034431). Peptide sequence TIDPADTNVRLKKDYLEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHC.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79844
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.