missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZCCHC24 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZCCHC24 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZCCHC24 Polyclonal specifically detects ZCCHC24 in Human samples. It is validated for Western Blot.Specifications
| ZCCHC24 | |
| Polyclonal | |
| Rabbit | |
| Q8N2G6 | |
| 219654 | |
| Synthetic peptides corresponding to C10ORF56 The peptide sequence was selected from the middle region of C10ORF56. Peptide sequence LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C10orf56, chromosome 10 open reading frame 56, FLJ90798, zinc finger CCHC domain-containing protein 24, zinc finger, CCHC domain containing 24 | |
| ZCCHC24 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title