ZCCHC24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56437

Product Code. 18277182

Description

ZCCHC24 Polyclonal specifically detects ZCCHC24 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZCCHC24
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C10orf56, chromosome 10 open reading frame 56, FLJ90798, zinc finger CCHC domain-containing protein 24, zinc finger, CCHC domain containing 24
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 219654
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N2G6
• Gene Symbols: ZCCHC24
• Immunogen: Synthetic peptides corresponding to C10ORF56 The peptide sequence was selected from the middle region of C10ORF56. Peptide sequence LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Rat: 100%; Chicken: 100%; Crab-eating macaque: 100%; Human: 100%; Zebrafish: 92%; Bovine: 92%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG