missing translation for 'onlineSavingsMsg'
Learn More
Learn More
YOD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £443.00
Specifications
| Antigen | YOD1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18407390
|
Novus Biologicals
NBP1-84172-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18253238
|
Novus Biologicals
NBP1-84172 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
YOD1 Polyclonal specifically detects YOD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| YOD1 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55432 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DKFZp451J1719, DUBA-8, DUBA8hsHIN7, EC 3.1.2, EC 3.4.19.12, HIN7, HIN-7, HIV-1-induced protease 7, HsHIN7, OTU domain-containing protein 2, OTUD2OTU domain containing 2, PRO0907, ubiquitin thioesterase OTU1, YOD1 OTU deubiquinating enzyme 1 homolog ( yeast), YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) | |
| YOD1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title