YOD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-84172

Product Code. 18253238

Description

YOD1 Polyclonal specifically detects YOD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: YOD1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: DKFZp451J1719, DUBA-8, DUBA8hsHIN7, EC 3.1.2, EC 3.4.19.12, HIN7, HIN-7, HIV-1-induced protease 7, HsHIN7, OTU domain-containing protein 2, OTUD2OTU domain containing 2, PRO0907, ubiquitin thioesterase OTU1, YOD1 OTU deubiquinating enzyme 1 homolog ( yeast), YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55432
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: YOD1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only