XCR1/CCXCR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18405061	Novus Biologicals NBP1-88143-25ul	25 μL
18292498	Novus Biologicals NBP1-88143	0.1 mL

Description

XCR1/CCXCR1 Polyclonal specifically detects XCR1/CCXCR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: XCR1/CCXCR1
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Chemokines and Cytokines
• Formulation: PBS (pH 7.2) and 40% glycerol with 0.02% Sodium Azide
• Gene Alias: CCXCR1XC chemokine receptor 1, chemokine (C motif) receptor 1, chemokine XC receptor 1, G protein-coupled receptor 5, GPR5chemokine (C motif) XC receptor 1, G-protein coupled receptor 5, Lymphotactin receptor
• Gene Symbols: XCR1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Concentration: 0.05mg/mL
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P25024
• Gene ID (Entrez): 2829
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MESSGNPESTTFFYYDLQSQPCENQAWVFATLA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only