missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XCR1/CCXCR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-88143-25ul
This item is not returnable.
View return policy
Description
XCR1/CCXCR1 Polyclonal specifically detects XCR1/CCXCR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| XCR1/CCXCR1 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% glycerol with 0.02% Sodium Azide | |
| CCXCR1XC chemokine receptor 1, chemokine (C motif) receptor 1, chemokine XC receptor 1, G protein-coupled receptor 5, GPR5chemokine (C motif) XC receptor 1, G-protein coupled receptor 5, Lymphotactin receptor | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.05mg/mL | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 | |
| P25024 | |
| XCR1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MESSGNPESTTFFYYDLQSQPCENQAWVFATLA | |
| 25 μL | |
| Chemokines and Cytokines | |
| 2829 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering