missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Wnt-9b Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | Wnt-9b |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Wnt-9b Polyclonal specifically detects Wnt-9b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Wnt-9b | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Protein Wnt-14b, wingless-type MMTV integration site family, member 15, wingless-type MMTV integration site family, member 9B, WNT14Bprotein Wnt-9b, WNT15Protein Wnt-15 | |
| WNT9B | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction, Wnt Signaling Pathway | |
| O14905 | |
| 7484 | |
| Synthetic peptides corresponding to WNT9B (wingless-type MMTV integration site family, member 9B) The peptide sequence was selected from the C terminal of WNT9B. Peptide sequence FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD. | |
| Primary | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title