missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WISP2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93612-0.02ml
This item is not returnable.
View return policy
Description
WISP2 Polyclonal antibody specifically detects WISP2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| WISP2 | |
| Polyclonal | |
| Western Blot 1:100 - 1:500, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Connective tissue growth factor-like protein, Connective tissue growth factor-related protein 58, CT58CTGF-Lwnt-1 signaling pathway protein 2, CTGFL, WISP-2, WNT1 inducible signaling pathway protein 2, WNT1-inducible-signaling pathway protein 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 164-250 of human WISP2 (NP_003872.1). GQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF | |
| 0.02 mL | |
| Cancer, Cardiovascular Biology, Stem Cells | |
| 8839 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction