missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WIPI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | WIPI1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WIPI1 Polyclonal specifically detects WIPI1 in Human samples. It is validated for Western Blot.Specifications
| WIPI1 | |
| Polyclonal | |
| Rabbit | |
| Q5MNZ9 | |
| 55062 | |
| Synthetic peptides corresponding to WIPI1(WD repeat domain, phosphoinositide interacting 1) The peptide sequence was selected from the middle region of WIPI1. Peptide sequence LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Atg18, Atg18 protein homolog, ATG18A, FLJ10055, WD repeat domain phosphoinositide-interacting protein 1, WD repeat domain, phosphoinositide interacting 1, WD40 repeat protein interacting with phosphoinositides of 49 kDa, WD40 repeat protein Interacting with phosphoInositides of 49kDa, WIPI 49 kDa, WIPI-1, WIPI-1 alpha, WIPI49ATG18 | |
| WIPI1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title