missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WIPI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56874
This item is not returnable.
View return policy
Description
WIPI1 Polyclonal specifically detects WIPI1 in Human samples. It is validated for Western Blot.
Specifications
| WIPI1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Atg18, Atg18 protein homolog, ATG18A, FLJ10055, WD repeat domain phosphoinositide-interacting protein 1, WD repeat domain, phosphoinositide interacting 1, WD40 repeat protein interacting with phosphoinositides of 49 kDa, WD40 repeat protein Interacting with phosphoInositides of 49kDa, WIPI 49 kDa, WIPI-1, WIPI-1 alpha, WIPI49ATG18 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 55062 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q5MNZ9 | |
| WIPI1 | |
| Synthetic peptides corresponding to WIPI1(WD repeat domain, phosphoinositide interacting 1) The peptide sequence was selected from the middle region of WIPI1. Peptide sequence LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRG. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Guinea pig: 92%; Pig: 92%; Rat: 92%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction