missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDPCP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | WDPCP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WDPCP Polyclonal specifically detects WDPCP in Human samples. It is validated for Western Blot.Specifications
| WDPCP | |
| Polyclonal | |
| Rabbit | |
| O95876-2 | |
| 51057 | |
| Synthetic peptides corresponding to LOC51057(hypothetical protein LOC51057) The peptide sequence was selected from the N terminal of LOC51057. Peptide sequence LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Bardet-Biedl syndrome 15 protein, BBS15C2orf86FRITZ, chromosome 2 open reading frame 86, DKFZp686C12204, fritz, FRTZ, hFrtz, WD repeat containing planar cell polarity effector, WD repeat-containing and planar cell polarity effector protein, WD repeat-containing protein C2orf86 | |
| WDPCP | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title