missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WASF3/WAVE3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£391.00
Specifications
| Antigen | WASF3/WAVE3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WASF3/WAVE3 Polyclonal specifically detects WASF3/WAVE3 in Human, Chicken samples. It is validated for Western Blot.Specifications
| WASF3/WAVE3 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| KIAA0900WASP family Verprolin-homologous protein 3, Protein WAVE-3, SCAR3WASP family protein member 3, Verprolin homology domain-containing protein 3, WAS protein family, member 3, WAVE3Brush-1, wisk | |
| WASF3 | |
| IgG | |
| 55 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UPY6 | |
| 10810 | |
| Synthetic peptides corresponding to WASF3(WAS protein family, member 3) The peptide sequence was selected from the middle region of WASF3. Peptide sequence RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title