WASF3/WAVE3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54993

Product Code. 18278472

Description

WASF3/WAVE3 Polyclonal specifically detects WASF3/WAVE3 in Human, Chicken samples. It is validated for Western Blot.

Specifications

• Antigen: WASF3/WAVE3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0900WASP family Verprolin-homologous protein 3, Protein WAVE-3, SCAR3WASP family protein member 3, Verprolin homology domain-containing protein 3, WAS protein family, member 3, WAVE3Brush-1, wisk
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 10810
• Target Species: Human, Mouse, Rat, Bovine, Canine, Chicken, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UPY6
• Gene Symbols: WASF3
• Immunogen: Synthetic peptides corresponding to WASF3(WAS protein family, member 3) The peptide sequence was selected from the middle region of WASF3. Peptide sequence RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.