Cylicin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56428-25ul

Product Code. 18685848

Description

Cylicin 1 Polyclonal specifically detects Cylicin 1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cylicin 1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Alias: CYCL1, CYL, CYL1, cylicin 1, cylicin I, cylicin, basic protein of sperm head cytoskeleton 1, cylicin-1, multiple-band polypeptide I
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1538
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CYLC1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KKDSKKDDKKKDAKKNAESTEMESDLELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKGSDTESEESLYKP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only