missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cylicin 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | Cylicin 1 |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18215583
|
Novus Biologicals
NBP2-56428 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18685848
|
Novus Biologicals
NBP2-56428-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cylicin 1 Polyclonal specifically detects Cylicin 1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Cylicin 1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CYCL1, CYL, CYL1, cylicin 1, cylicin I, cylicin, basic protein of sperm head cytoskeleton 1, cylicin-1, multiple-band polypeptide I | |
| CYLC1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1538 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KKDSKKDDKKKDAKKNAESTEMESDLELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKGSDTESEESLYKP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title