missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VCIP135/VCPIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | VCIP135/VCPIP1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18446531
|
Novus Biologicals
NBP2-13515 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18430672
|
Novus Biologicals
NBP2-13515-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VCIP135/VCPIP1 Polyclonal antibody specifically detects VCIP135/VCPIP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| VCIP135/VCPIP1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.2) and 40% Glycerol | |
| 80124 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DKFZp686G038, DUBA3, EC 3.4.22.-, FLJ23132, KIAA1850FLJ60694, valosin containing protein (p97)/p47 complex interacting protein 1, valosin-containing protein (p97)/p47 complex-interacting protein p135, Valosin-containing protein p97/p47 complex-interacting protein 1, Valosin-containing protein p97/p47 complex-interacting protein p135, VCIP135deubiquitinating protein VCIP135, VCPIP1 VCIP135 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: LLCGALSELHVPPEWLAPGGKLYNLAKSTHGQLRTDKNYSFPLNNLVCSYDSVKDVLVPDYGMSNLTACNWCHGTSVRKVRGDGSIVYLDG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title