missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VCIP135/VCPIP1 Antibody, Novus Biologicals™

VCIP135/VCPIP1 Antibody, Novus Biologicals™

Product Code. 18446531 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18446531 0.1 mL 0.10mL
18430672 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18446531 Supplier Novus Biologicals Supplier No. NBP213515

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

VCIP135/VCPIP1 Polyclonal antibody specifically detects VCIP135/VCPIP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen VCIP135/VCPIP1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias DKFZp686G038, DUBA3, EC 3.4.22.-, FLJ23132, KIAA1850FLJ60694, valosin containing protein (p97)/p47 complex interacting protein 1, valosin-containing protein (p97)/p47 complex-interacting protein p135, Valosin-containing protein p97/p47 complex-interacting protein 1, Valosin-containing protein p97/p47 complex-interacting protein p135, VCIP135deubiquitinating protein VCIP135, VCPIP1 VCIP135
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: LLCGALSELHVPPEWLAPGGKLYNLAKSTHGQLRTDKNYSFPLNNLVCSYDSVKDVLVPDYGMSNLTACNWCHGTSVRKVRGDGSIVYLDG
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 80124
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.