missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VCIP135/VCPIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13515
This item is not returnable.
View return policy
Description
VCIP135/VCPIP1 Polyclonal antibody specifically detects VCIP135/VCPIP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| VCIP135/VCPIP1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| DKFZp686G038, DUBA3, EC 3.4.22.-, FLJ23132, KIAA1850FLJ60694, valosin containing protein (p97)/p47 complex interacting protein 1, valosin-containing protein (p97)/p47 complex-interacting protein p135, Valosin-containing protein p97/p47 complex-interacting protein 1, Valosin-containing protein p97/p47 complex-interacting protein p135, VCIP135deubiquitinating protein VCIP135, VCPIP1 VCIP135 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: LLCGALSELHVPPEWLAPGGKLYNLAKSTHGQLRTDKNYSFPLNNLVCSYDSVKDVLVPDYGMSNLTACNWCHGTSVRKVRGDGSIVYLDG | |
| 0.1 mL | |
| Cell Biology | |
| 80124 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction