missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UTP20 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58128-25ul
This item is not returnable.
View return policy
Description
UTP20 Polyclonal specifically detects UTP20 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| UTP20 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| Down-regulated in metastasis protein, DRIMdown regulated in metastasis, NNP73, Novel nucleolar protein 73, Protein Key-1A6, small subunit processome component 20 homolog, UTP20, small subunit (SSU) processome component, homolog (yeast) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| UTP20 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC | |
| 25 μL | |
| Cell Cycle and Replication | |
| 27340 | |
| Human | |
| IgG |
Product Content Correction
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion