UTP20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58128-25ul

Product Code. 18601208

Description

UTP20 Polyclonal specifically detects UTP20 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: UTP20
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Down-regulated in metastasis protein, DRIMdown regulated in metastasis, NNP73, Novel nucleolar protein 73, Protein Key-1A6, small subunit processome component 20 homolog, UTP20, small subunit (SSU) processome component, homolog (yeast)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: UTP20
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 27340
• Target Species: Human
• Isotype: IgG

For Research Use Only