missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP38 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | USP38 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18233492
|
Novus Biologicals
NBP2-58097 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18614586
|
Novus Biologicals
NBP2-58097-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
USP38 Polyclonal specifically detects USP38 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| USP38 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 84640 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEHWLDEAQCEAMFDLTTRLILEGQDPFQRQVGHQVLEAYARYHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Deubiquitinating enzyme 38, EC 3.4.19.12, HP43.8KDFLJ35970, KIAA1891ubiquitin specific protease 38, ubiquitin carboxyl-terminal hydrolase 38, ubiquitin specific peptidase 38, ubiquitin thioesterase 38, Ubiquitin thiolesterase 38, Ubiquitin-specific-processing protease 38 | |
| USP38 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title