USP38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58097

Product Code. 18233492

Description

USP38 Polyclonal specifically detects USP38 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: USP38
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Deubiquitinating enzyme 38, EC 3.4.19.12, HP43.8KDFLJ35970, KIAA1891ubiquitin specific protease 38, ubiquitin carboxyl-terminal hydrolase 38, ubiquitin specific peptidase 38, ubiquitin thioesterase 38, Ubiquitin thiolesterase 38, Ubiquitin-specific-processing protease 38
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84640
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: USP38
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEHWLDEAQCEAMFDLTTRLILEGQDPFQRQVGHQVLEAYARYHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only