USP22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18437010	Novus Biologicals NBP1-82941-25ul	25 μL
18274207	Novus Biologicals NBP1-82941	0.1 mL

Description

USP22 Polyclonal specifically detects USP22 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: USP22
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, Cell Cycle and Replication, Signal Transduction, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Deubiquitinating enzyme 22, EC 3.1.2.15, EC 3.4.19.12, KIAA1063ubiquitin carboxyl-terminal hydrolase 22, KIAA1064, ubiquitin specific peptidase 22, ubiquitin specific peptidase 3-like, ubiquitin specific protease 22, ubiquitin thioesterase 22, Ubiquitin thiolesterase 22, ubiquitin-specific processing protease 22, Ubiquitin-specific-processing protease 22, USP3L
• Gene Symbols: USP22
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q9UPT9
• Gene ID (Entrez): 23326
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 60 kDa

For Research Use Only